PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G155900.1.p
Common NameSb05g021820, SORBIDRAFT_05g021820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 297aa    MW: 32148.4 Da    PI: 6.6062
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G155900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.5e-171562148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd  lv +++q+G+g+W+++++  g+ R+ k+c++rw +yl
  Sobic.005G155900.1.p 15 KGPWTPEEDIVLVSYIQQHGPGNWRSVPENTGLMRCSKSCRLRWTNYL 62
                          79********************************************97 PP

2Myb_DNA-binding47.34.6e-1568113148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg++T+ E+ +++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Sobic.005G155900.1.p  68 RGNFTPHEEGIIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 113
                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.2471066IPR017930Myb domain
SuperFamilySSF466891.64E-3012109IPR009057Homeodomain-like
SMARTSM007175.7E-131464IPR001005SANT/Myb domain
PfamPF002491.3E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-231669IPR009057Homeodomain-like
CDDcd001678.19E-121762No hitNo description
SMARTSM007172.4E-1367115IPR001005SANT/Myb domain
PROSITE profilePS5129419.14867117IPR017930Myb domain
PfamPF002492.5E-1368113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2470117IPR009057Homeodomain-like
CDDcd001675.34E-1070113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MGRPPCCDNG VGVKKGPWTP EEDIVLVSYI QQHGPGNWRS VPENTGLMRC SKSCRLRWTN  60
YLRPGIKRGN FTPHEEGIII HLQALLGNKW AAIASYLPQR TDNDIKNYWN THLKKKVKRL  120
QQPAAAESFQ TTAAASNAVT CSPNYYSSSS SSHHSLQGMQ QPMSSYPNTA CSSSTPSNHE  180
TTTTTGVSDL FQTWMMRPSP LAAAAAAADN CKIAMQEFQE EQASIVCQEQ MVMTGGGDVN  240
NKSSALEMMV APAVMGASTA TFSLLEDWLL DDMPGQVAMD GLMGISAGCC ADPIMF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-261511727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9555500.0EU955550.1 Zea mays clone 1536772 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450969.10.0hypothetical protein SORBIDRAFT_05g021820
TrEMBLC5Y4R20.0C5Y4R2_SORBI; Putative uncharacterized protein Sb05g021820
STRINGSb05g021820.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.12e-80myb domain protein 60